LOXL1 antibody (70R-5381)

Rabbit polyclonal LOXL1 antibody raised against the middle region of LOXL1

Synonyms Polyclonal LOXL1 antibody, Anti-LOXL1 antibody, LOXL1, LOXL 1, LOXL-1, Lysyl Oxidase-Like 1 antibody, LOXL-1 antibody, LOL antibody, LOXL antibody, LOXL 1 antibody
Specificity LOXL1 antibody was raised against the middle region of LOXL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP
Assay Information LOXL1 Blocking Peptide, catalog no. 33R-10229, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody

Images

Western Blot analysis using LOXL1 antibody (70R-5381)

LOXL1 antibody (70R-5381) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOXL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOXL1 antibody (70R-5381) | LOXL1 antibody (70R-5381) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors