LOXL3 Blocking Peptide (33R-1049)

A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL3 antibody, catalog no. 70R-10022

Synonyms LOXL3 control peptide, LOXL3 antibody Blocking Peptide, Anti-LOXL3 Blocking Peptide, lysyl oxidase-like 3 Blocking Peptide, LOXL Blocking Peptide, LOXL3, LOXL-3, LOXL 3, LOXL-3 Blocking Peptide, LOXL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD
Molecular Weight 80 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LOXL3 is a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors