LPP antibody (70R-2082)
Rabbit polyclonal LPP antibody raised against the N terminal of LPP
Overview
Overview
Synonyms | Polyclonal LPP antibody, Anti-LPP antibody, Lim Domain Containing Preferred Translocation Partner In Lipoma antibody |
---|---|
Specificity | LPP antibody was raised against the N terminal of LPP |
Cross Reactivity | Human |
Applications | WB |
Immunogen | LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST |
Assay Information | LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody |
Images
Western Blot analysis using LPP antibody (70R-2082)
LPP antibody (70R-2082) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 67 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LPP antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product