LRCH4 antibody (70R-7117)

Rabbit polyclonal LRCH4 antibody

Synonyms Polyclonal LRCH4 antibody, Anti-LRCH4 antibody, LRCH 4, Leucine-Rich Repeats And Calponin Homology antibody, LRRN1 antibody, LRN antibody, LRRN4 antibody, LRCH-4 antibody, LRCH 4 antibody, LRCH4, FLJ40101 antibody, FLJ46315 antibody, LRCH-4, Ch Domain Containing 4 antibody, PP14183 antibody, SAP25 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPR
Assay Information LRCH4 Blocking Peptide, catalog no. 33R-7104, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody


Western Blot analysis using LRCH4 antibody (70R-7117)

LRCH4 antibody (70R-7117) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRCH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRCH4 antibody (70R-7117) | LRCH4 antibody (70R-7117) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors