LRFN3 antibody (70R-7159)

Rabbit polyclonal LRFN3 antibody raised against the C terminal of LRFN3

Synonyms Polyclonal LRFN3 antibody, Anti-LRFN3 antibody, MGC2656 antibody, FIGLER1 antibody, LRFN 3 antibody, Leucine Rich Repeat And Fibronectin Type Iii Domain Containing 3 antibody, LRFN3, LRFN 3, SALM4 antibody, LRFN-3, LRFN-3 antibody
Specificity LRFN3 antibody was raised against the C terminal of LRFN3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS
Assay Information LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody

Images

Western Blot analysis using LRFN3 antibody (70R-7159)

LRFN3 antibody (70R-7159) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRFN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRFN3 belongs to the LRFN family. Its exact function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRFN3 antibody (70R-7159) | LRFN3 antibody (70R-7159) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors