LRFN5 antibody (70R-7539)

Rabbit polyclonal LRFN5 antibody raised against the middle region of LRFN5

Synonyms Polyclonal LRFN5 antibody, Anti-LRFN5 antibody, FIGLER8 antibody, LRFN-5, C14orf146 antibody, LRFN 5, LRFN 5 antibody, LRFN5, Leucine Rich Repeat And Fibronectin Type Iii Domain Containing 5 antibody, LRFN-5 antibody, DKFZp686G0210 antibody, FLJ30803 antibody
Specificity LRFN5 antibody was raised against the middle region of LRFN5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV
Assay Information LRFN5 Blocking Peptide, catalog no. 33R-7195, is also available for use as a blocking control in assays to test for specificity of this LRFN5 antibody

Images

Western Blot analysis using LRFN5 antibody (70R-7539)

LRFN5 antibody (70R-7539) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRFN5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of LRFN5 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRFN5 antibody (70R-7539) | LRFN5 antibody (70R-7539) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors