LRG1 antibody (70R-4512)

Rabbit polyclonal LRG1 antibody raised against the N terminal of LRG1

Synonyms Polyclonal LRG1 antibody, Anti-LRG1 antibody, LRG antibody, LRG 1 antibody, LRG 1, LRG-1, HMFT1766 antibody, LRG1, LRG-1 antibody, Leucine-Rich Alpha-2-Glycoprotein 1 antibody
Specificity LRG1 antibody was raised against the N terminal of LRG1
Cross Reactivity Human
Applications WB
Immunogen LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Assay Information LRG1 Blocking Peptide, catalog no. 33R-3657, is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody


Western Blot analysis using LRG1 antibody (70R-4512)

LRG1 antibody (70R-4512) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRG1 antibody (70R-4512) | LRG1 antibody (70R-4512) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors