LRP2BP antibody (70R-3858)

Rabbit polyclonal LRP2BP antibody raised against the middle region of LRP2BP

Synonyms Polyclonal LRP2BP antibody, Anti-LRP2BP antibody, LRPBP-2 antibody, LRP2BP, Lrp2 Binding Protein antibody, LRPBP 2, LRPBP-2, DKFZp761O0113 antibody, LRPBP 2 antibody
Specificity LRP2BP antibody was raised against the middle region of LRP2BP
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen LRP2BP antibody was raised using the middle region of LRP2BP corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE
Assay Information LRP2BP Blocking Peptide, catalog no. 33R-8200, is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody


Western Blot analysis using LRP2BP antibody (70R-3858)

LRP2BP antibody (70R-3858) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRP2BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRP2BP may act as an adapter that regulates LRP2 function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRP2BP antibody (70R-3858) | LRP2BP antibody (70R-3858) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors