LRP8 antibody (70R-7376)

Rabbit polyclonal LRP8 antibody raised against the middle region of LRP8

Synonyms Polyclonal LRP8 antibody, Anti-LRP8 antibody, LRP 8 antibody, LRP-8 antibody, LRP-8, APOER2 antibody, MCI1 antibody, LRP 8, HSZ75190 antibody, LRP8, Low Density Lipoprotein Receptor-Related Protein 8 Apolipoprotein E Receptor antibody
Specificity LRP8 antibody was raised against the middle region of LRP8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV
Assay Information LRP8 Blocking Peptide, catalog no. 33R-1575, is also available for use as a blocking control in assays to test for specificity of this LRP8 antibody

Images

Immunohistochemical staining using LRP8 antibody (70R-7376)

LRP8 antibody staining of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRP8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using LRP8 antibody (70R-7376) | LRP8 antibody staining of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
  • Western blot analysis using LRP8 antibody (70R-7376) | Recommended LRP8 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors