LRRC15 antibody (70R-7278)

Rabbit polyclonal LRRC15 antibody raised against the N terminal of LRRC15

Synonyms Polyclonal LRRC15 antibody, Anti-LRRC15 antibody, LRRC 15, LRRC15, Leucine Rich Repeat Containing 15 antibody, LRRC 15 antibody, LRRC-15 antibody, LIB antibody, LRRC-15
Specificity LRRC15 antibody was raised against the N terminal of LRRC15
Cross Reactivity Human,Rat
Applications WB
Immunogen LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
Assay Information LRRC15 Blocking Peptide, catalog no. 33R-5224, is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Images

Western Blot analysis using LRRC15 antibody (70R-7278)

LRRC15 antibody (70R-7278) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC15 antibody (70R-7278) | LRRC15 antibody (70R-7278) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors