LRRC17 antibody (70R-4120)

Rabbit polyclonal LRRC17 antibody raised against the middle region of LRRC17

Synonyms Polyclonal LRRC17 antibody, Anti-LRRC17 antibody, LRRC-17, LRRC 17 antibody, Leucine Rich Repeat Containing 17 antibody, LRRC17, LRRC-17 antibody, P37NB antibody, LRRC 17
Specificity LRRC17 antibody was raised against the middle region of LRRC17
Cross Reactivity Human
Applications WB
Immunogen LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
Assay Information LRRC17 Blocking Peptide, catalog no. 33R-10275, is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody

Images

Western Blot analysis using LRRC17 antibody (70R-4120)

LRRC17 antibody (70R-4120) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC17 antibody (70R-4120) | LRRC17 antibody (70R-4120) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors