LRRC2 antibody (70R-3937)

Rabbit polyclonal LRRC2 antibody raised against the N terminal of LRRC2

Synonyms Polyclonal LRRC2 antibody, Anti-LRRC2 antibody, LRRC-2, Leucine Rich Repeat Containing 2 antibody, LRRC 2, LRRC2, LRRC 2 antibody, LRRC-2 antibody
Specificity LRRC2 antibody was raised against the N terminal of LRRC2
Cross Reactivity Human
Applications WB
Immunogen LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA
Assay Information LRRC2 Blocking Peptide, catalog no. 33R-3309, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody


Western Blot analysis using LRRC2 antibody (70R-3937)

LRRC2 antibody (70R-3937) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRRC2 antibody (70R-3937) | LRRC2 antibody (70R-3937) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors