LRRC23 antibody (70R-3964)

Rabbit polyclonal LRRC23 antibody raised against the middle region of LRRC23

Synonyms Polyclonal LRRC23 antibody, Anti-LRRC23 antibody, LRPB7 antibody, Leucine Rich Repeat Containing 23 antibody, LRRC23, LRRC 23 antibody, LRRC-23, LRRC-23 antibody, LRRC 23
Specificity LRRC23 antibody was raised against the middle region of LRRC23
Cross Reactivity Human
Applications WB
Immunogen LRRC23 antibody was raised using the middle region of LRRC23 corresponding to a region with amino acids ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH
Assay Information LRRC23 Blocking Peptide, catalog no. 33R-4156, is also available for use as a blocking control in assays to test for specificity of this LRRC23 antibody


Western Blot analysis using LRRC23 antibody (70R-3964)

LRRC23 antibody (70R-3964) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRRC23 antibody (70R-3964) | LRRC23 antibody (70R-3964) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors