LRRC23 antibody (70R-4072)

Rabbit polyclonal LRRC23 antibody raised against the N terminal of LRRC23

Synonyms Polyclonal LRRC23 antibody, Anti-LRRC23 antibody, LRRC-23 antibody, LRRC23, LRRC 23, LRPB7 antibody, LRRC 23 antibody, LRRC-23, Leucine Rich Repeat Containing 23 antibody
Specificity LRRC23 antibody was raised against the N terminal of LRRC23
Cross Reactivity Human
Applications WB
Immunogen LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN
Assay Information LRRC23 Blocking Peptide, catalog no. 33R-4931, is also available for use as a blocking control in assays to test for specificity of this LRRC23 antibody

Images

Western Blot analysis using LRRC23 antibody (70R-4072)

LRRC23 antibody (70R-4072) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC23 antibody (70R-4072) | LRRC23 antibody (70R-4072) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors