LRRC26 antibody (70R-6595)

Rabbit polyclonal LRRC26 antibody raised against the middle region of Lrrc26

Synonyms Polyclonal LRRC26 antibody, Anti-LRRC26 antibody, LRRC26, LRRC-26, LRRC 26 antibody, LRRC 26, LRRC-26 antibody, bA350O14.10 antibody, Leucine Rich Repeat Containing 26 antibody
Specificity LRRC26 antibody was raised against the middle region of Lrrc26
Cross Reactivity Human,Dog
Applications WB
Immunogen LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
Assay Information LRRC26 Blocking Peptide, catalog no. 33R-5378, is also available for use as a blocking control in assays to test for specificity of this LRRC26 antibody

Images

Western Blot analysis using LRRC26 antibody (70R-6595)

LRRC26 antibody (70R-6595) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC26 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC26 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha), required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These are characterized by negative membrane voltages and constant low levels of calcium.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC26 antibody (70R-6595) | LRRC26 antibody (70R-6595) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors