LRRC28 antibody (70R-1980)

Rabbit polyclonal LRRC28 antibody raised against the N terminal of LRRC28

Synonyms Polyclonal LRRC28 antibody, Anti-LRRC28 antibody, LRRC-28, MGC24976 antibody, Leucine Rich Repeat Containing 28 antibody, LRRC-28 antibody, LRRC 28, FLJ45242 antibody, FLJ34269 antibody, LRRC 28 antibody, LRRC28
Specificity LRRC28 antibody was raised against the N terminal of LRRC28
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG
Assay Information LRRC28 Blocking Peptide, catalog no. 33R-4280, is also available for use as a blocking control in assays to test for specificity of this LRRC28 antibody


Western Blot analysis using LRRC28 antibody (70R-1980)

LRRC28 antibody (70R-1980) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRRC28 antibody (70R-1980) | LRRC28 antibody (70R-1980) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors