LRRC33 antibody (70R-7519)

Rabbit polyclonal LRRC33 antibody raised against the N terminal of LRRC33

Synonyms Polyclonal LRRC33 antibody, Anti-LRRC33 antibody, UNQ3030 antibody, LRRC 33, LRRC 33 antibody, GARPL1 antibody, LRRC33, MGC50789 antibody, Leucine Rich Repeat Containing 33 antibody, LRRC-33, LRRC-33 antibody
Specificity LRRC33 antibody was raised against the N terminal of LRRC33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL
Assay Information LRRC33 Blocking Peptide, catalog no. 33R-3389, is also available for use as a blocking control in assays to test for specificity of this LRRC33 antibody

Images

Western Blot analysis using LRRC33 antibody (70R-7519)

LRRC33 antibody (70R-7519) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC33 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC33 antibody (70R-7519) | LRRC33 antibody (70R-7519) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors