LRRC37A3 antibody (70R-7010)

Rabbit polyclonal LRRC37A3 antibody raised against the middle region of LRRC37A3

Synonyms Polyclonal LRRC37A3 antibody, Anti-LRRC37A3 antibody, LRRCA3-37, MGC41826 antibody, FLJ34306 antibody, KIAA0563 antibody, LRRCA3-37 antibody, MGC57168 antibody, LRRCA3 37 antibody, LRRCA3 37, LRRC37A3, Leucine Rich Repeat Containing 37 Member A3 antibody
Specificity LRRC37A3 antibody was raised against the middle region of LRRC37A3
Cross Reactivity Human
Applications WB
Immunogen LRRC37A3 antibody was raised using the middle region of LRRC37A3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS
Assay Information LRRC37A3 Blocking Peptide, catalog no. 33R-6945, is also available for use as a blocking control in assays to test for specificity of this LRRC37A3 antibody

Images

Western Blot analysis using LRRC37A3 antibody (70R-7010)

LRRC37A3 antibody (70R-7010) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 180 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC37A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC37A3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC37A3 antibody (70R-7010) | LRRC37A3 antibody (70R-7010) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors