LRRC37B antibody (70R-6920)

Rabbit polyclonal LRRC37B antibody raised against the N terminal of LRRC37B

Synonyms Polyclonal LRRC37B antibody, Anti-LRRC37B antibody, LRRCB-37, LRRCB 37 antibody, LRRCB-37 antibody, Leucine Rich Repeat Containing 37B antibody, LRRC37B, LRRCB 37
Specificity LRRC37B antibody was raised against the N terminal of LRRC37B
Cross Reactivity Human
Applications WB
Immunogen LRRC37B antibody was raised using the N terminal of LRRC37B corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS
Assay Information LRRC37B Blocking Peptide, catalog no. 33R-9822, is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Images

Western Blot analysis using LRRC37B antibody (70R-6920)

LRRC37B antibody (70R-6920) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC37B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC37B antibody (70R-6920) | LRRC37B antibody (70R-6920) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors