LRRC42 antibody (70R-4131)

Rabbit polyclonal LRRC42 antibody raised against the N terminal of LRRC42

Synonyms Polyclonal LRRC42 antibody, Anti-LRRC42 antibody, LRRC 42 antibody, LRRC-42, MGC8974 antibody, dJ167A19.4 antibody, LRRC42, LRRC-42 antibody, LRRC 42, Leucine Rich Repeat Containing 42 antibody
Specificity LRRC42 antibody was raised against the N terminal of LRRC42
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR
Assay Information LRRC42 Blocking Peptide, catalog no. 33R-5043, is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Images

Western Blot analysis using LRRC42 antibody (70R-4131)

LRRC42 antibody (70R-4131) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC42 antibody (70R-4131) | LRRC42 antibody (70R-4131) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors