LRRC49 antibody (70R-3414)

Rabbit polyclonal LRRC49 antibody raised against the N terminal of LRRC49

Synonyms Polyclonal LRRC49 antibody, Anti-LRRC49 antibody, LRRC49, LRRC-49 antibody, LRRC 49 antibody, Leucine Rich Repeat Containing 49 antibody, FLJ20156 antibody, LRRC 49, LRRC-49
Specificity LRRC49 antibody was raised against the N terminal of LRRC49
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS
Assay Information LRRC49 Blocking Peptide, catalog no. 33R-4703, is also available for use as a blocking control in assays to test for specificity of this LRRC49 antibody

Images

Western Blot analysis using LRRC49 antibody (70R-3414)

LRRC49 antibody (70R-3414) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC49 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC49 antibody (70R-3414) | LRRC49 antibody (70R-3414) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors