LRRC4C antibody (70R-6577)

Rabbit polyclonal LRRC4C antibody raised against the N terminal of LRRC4C

Synonyms Polyclonal LRRC4C antibody, Anti-LRRC4C antibody, NGL1 antibody, LRRCC 4, LRRCC-4 antibody, NGL-1 antibody, KIAA1580 antibody, LRRCC 4 antibody, LRRC4C, LRRCC-4, Leucine Rich Repeat Containing 4C antibody
Specificity LRRC4C antibody was raised against the N terminal of LRRC4C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC4C antibody was raised using the N terminal of LRRC4C corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Assay Information LRRC4C Blocking Peptide, catalog no. 33R-5546, is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody

Images

Western Blot analysis using LRRC4C antibody (70R-6577)

LRRC4C antibody (70R-6577) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC4C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC4C antibody (70R-6577) | LRRC4C antibody (70R-6577) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors