LRRC52 antibody (70R-6320)

Rabbit polyclonal LRRC52 antibody raised against the N terminal of LRRC52

Synonyms Polyclonal LRRC52 antibody, Anti-LRRC52 antibody, LRRC-52 antibody, LRRC52, LRRC 52 antibody, LRRC-52, LRRC 52, FLJ25811 antibody, Leucine Rich Repeat Containing 52 antibody
Specificity LRRC52 antibody was raised against the N terminal of LRRC52
Cross Reactivity Human
Applications WB
Immunogen LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC
Assay Information LRRC52 Blocking Peptide, catalog no. 33R-7542, is also available for use as a blocking control in assays to test for specificity of this LRRC52 antibody

Images

Western Blot analysis using LRRC52 antibody (70R-6320)

LRRC52 antibody (70R-6320) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC52 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC52 antibody (70R-6320) | LRRC52 antibody (70R-6320) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors