LRRC57 antibody (70R-3230)

Rabbit polyclonal LRRC57 antibody raised against the N terminal of LRRC57

Synonyms Polyclonal LRRC57 antibody, Anti-LRRC57 antibody, LRRC-57 antibody, LRRC 57, LRRC57, LRRC 57 antibody, Leucine Rich Repeat Containing 57 antibody, LRRC-57, FLJ36812 antibody, DKFZp686H1865 antibody
Specificity LRRC57 antibody was raised against the N terminal of LRRC57
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI
Assay Information LRRC57 Blocking Peptide, catalog no. 33R-6050, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Images

Western Blot analysis using LRRC57 antibody (70R-3230)

LRRC57 antibody (70R-3230) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC57 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC57 antibody (70R-3230) | LRRC57 antibody (70R-3230) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors