LRRC57 antibody (70R-4255)

Rabbit polyclonal LRRC57 antibody raised against the middle region of LRRC57

Synonyms Polyclonal LRRC57 antibody, Anti-LRRC57 antibody, LRRC-57, Leucine Rich Repeat Containing 57 antibody, LRRC-57 antibody, LRRC 57 antibody, LRRC57, LRRC 57, FLJ36812 antibody, DKFZp686H1865 antibody
Specificity LRRC57 antibody was raised against the middle region of LRRC57
Cross Reactivity Human,Mouse
Applications WB
Immunogen LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
Assay Information LRRC57 Blocking Peptide, catalog no. 33R-6807, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Images

Western Blot analysis using LRRC57 antibody (70R-4255)

LRRC57 antibody (70R-4255) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC57 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC57 antibody (70R-4255) | LRRC57 antibody (70R-4255) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors