LRRC59 antibody (70R-6891)

Rabbit polyclonal LRRC59 antibody raised against the C terminal of LRRC59

Synonyms Polyclonal LRRC59 antibody, Anti-LRRC59 antibody, LRRC-59 antibody, FLJ21675 antibody, Leucine Rich Repeat Containing 59 antibody, PRO1855 antibody, LRRC-59, LRRC 59, LRRC59, LRRC 59 antibody
Specificity LRRC59 antibody was raised against the C terminal of LRRC59
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL
Assay Information LRRC59 Blocking Peptide, catalog no. 33R-4365, is also available for use as a blocking control in assays to test for specificity of this LRRC59 antibody

Images

Immunohistochemical staining using LRRC59 antibody (70R-6891)

LRRC59 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC59 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC59 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using LRRC59 antibody (70R-6891) | LRRC59 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LRRC59 antibody (70R-6891) | LRRC59 antibody (70R-6891) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using LRRC59 antibody (70R-6891) | LRRC59 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors