LRRC66 antibody (70R-6659)

Rabbit polyclonal LRRC66 antibody raised against the middle region of LRRC66

Synonyms Polyclonal LRRC66 antibody, Anti-LRRC66 antibody, LRRC-66 antibody, LRRC 66, Leucine Rich Repeat Containing 66) antibody, LRRC 66 antibody, LRRC66, LRRC-66
Specificity LRRC66 antibody was raised against the middle region of LRRC66
Cross Reactivity Human
Applications WB
Immunogen LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW
Assay Information LRRC66 Blocking Peptide, catalog no. 33R-6926, is also available for use as a blocking control in assays to test for specificity of this LRRC66 antibody

Images

Western Blot analysis using LRRC66 antibody (70R-6659)

LRRC66 antibody (70R-6659) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC66 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC66 antibody (70R-6659) | LRRC66 antibody (70R-6659) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors