LRRC8A antibody (70R-6449)

Rabbit polyclonal LRRC8A antibody raised against the middle region of LRRC8A

Synonyms Polyclonal LRRC8A antibody, Anti-LRRC8A antibody, FLJ10337 antibody, LRRCA-8 antibody, LRRC8A, LRRCA 8 antibody, LRRC8 antibody, LRRCA 8, Leucine Rich Repeat Containing 8 Family Member A antibody, KIAA1437 antibody, LRRCA-8
Specificity LRRC8A antibody was raised against the middle region of LRRC8A
Cross Reactivity Human
Applications WB
Immunogen LRRC8A antibody was raised using the middle region of LRRC8A corresponding to a region with amino acids NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR
Assay Information LRRC8A Blocking Peptide, catalog no. 33R-6781, is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody

Images

Western Blot analysis using LRRC8A antibody (70R-6449)

LRRC8A antibody (70R-6449) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC8A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC8A antibody (70R-6449) | LRRC8A antibody (70R-6449) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors