LRRC8B antibody (70R-6538)

Rabbit polyclonal LRRC8B antibody raised against the middle region of LRRC8B

Synonyms Polyclonal LRRC8B antibody, Anti-LRRC8B antibody, MGC42220 antibody, KIAA0231 antibody, Leucine Rich Repeat Containing 8 Family Member B antibody, TA-LRRP antibody, LRRC8B, LRRCB-8 antibody, LRRCB-8, LRRCB 8, LRRCB 8 antibody
Specificity LRRC8B antibody was raised against the middle region of LRRC8B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRC8B antibody was raised using the middle region of LRRC8B corresponding to a region with amino acids TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE
Assay Information LRRC8B Blocking Peptide, catalog no. 33R-9195, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody


Immunohistochemical staining using LRRC8B antibody (70R-6538)

LRRC8B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC8B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LRRC8B antibody (70R-6538) | LRRC8B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LRRC8B antibody (70R-6538) | LRRC8B antibody (70R-6538) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using LRRC8B antibody (70R-6538) | LRRC8B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors