LRRN3 antibody (70R-6404)

Rabbit polyclonal LRRN3 antibody raised against the N terminal of LRRN3

Synonyms Polyclonal LRRN3 antibody, Anti-LRRN3 antibody, LRRN-3, NLRR3 antibody, NLRR-3 antibody, Leucine Rich Repeat Neuronal 3 antibody, LRRN3, FLJ11129 antibody, FIGLER5 antibody, LRRN-3 antibody, LRRN 3 antibody, LRRN 3
Specificity LRRN3 antibody was raised against the N terminal of LRRN3
Cross Reactivity Human
Applications WB
Immunogen LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
Assay Information LRRN3 Blocking Peptide, catalog no. 33R-2582, is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody

Images

Western Blot analysis using LRRN3 antibody (70R-6404)

LRRN3 antibody (70R-6404) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRN3 antibody (70R-6404) | LRRN3 antibody (70R-6404) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors