LRRTM1 antibody (70R-7180)

Rabbit polyclonal LRRTM1 antibody raised against the middle region of LRRTM1

Synonyms Polyclonal LRRTM1 antibody, Anti-LRRTM1 antibody, LRRTM 1, LRRTM-1 antibody, FLJ32082 antibody, LRRTM 1 antibody, Leucine Rich Repeat Transmembrane Neuronal 1 antibody, LRRTM1, LRRTM-1
Specificity LRRTM1 antibody was raised against the middle region of LRRTM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG
Assay Information LRRTM1 Blocking Peptide, catalog no. 33R-1644, is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody

Images

Western Blot analysis using LRRTM1 antibody (70R-7180)

LRRTM1 antibody (70R-7180) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRTM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRTM1 antibody (70R-7180) | LRRTM1 antibody (70R-7180) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors