LSAMP antibody (70R-6118)

Rabbit polyclonal LSAMP antibody raised against the N terminal of LSAMP

Synonyms Polyclonal LSAMP antibody, Anti-LSAMP antibody, Limbic System-Associated Membrane Protein antibody, LAMP antibody
Specificity LSAMP antibody was raised against the N terminal of LSAMP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI
Assay Information LSAMP Blocking Peptide, catalog no. 33R-6605, is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Images

Western Blot analysis using LSAMP antibody (70R-6118)

LSAMP antibody (70R-6118) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSAMP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LSAMP antibody (70R-6118) | LSAMP antibody (70R-6118) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors