LSM12 antibody (70R-4159)

Rabbit polyclonal LSM12 antibody

Synonyms Polyclonal LSM12 antibody, Anti-LSM12 antibody, Lsm12 Homolog antibody, LSM 12 antibody, PNAS-135 antibody, FLJ30656 antibody, LSM-12, LSM12, LSM 12, MGC104211 antibody, LSM-12 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL
Assay Information LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody


Western Blot analysis using LSM12 antibody (70R-4159)

LSM12 antibody (70R-4159) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LSM12 antibody (70R-4159) | LSM12 antibody (70R-4159) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors