LSM14A antibody (70R-3543)

Rabbit polyclonal LSM14A antibody

Synonyms Polyclonal LSM14A antibody, Anti-LSM14A antibody, LSMA-14, FAM61A antibody, RAP55 antibody, LSMA-14 antibody, DKFZP434D1335 antibody, LSMA 14 antibody, LSM14A, LSMA 14, Lsm14A Scd6 Homolog A antibody, C19orf13 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP
Assay Information LSM14A Blocking Peptide, catalog no. 33R-9285, is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody


Western Blot analysis using LSM14A antibody (70R-3543)

LSM14A antibody (70R-3543) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM14A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LSM14A antibody (70R-3543) | LSM14A antibody (70R-3543) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors