LSM4 antibody (70R-4945)

Rabbit polyclonal LSM4 antibody

Synonyms Polyclonal LSM4 antibody, Anti-LSM4 antibody, LSM 4 antibody, YER112W antibody, LSM4, LSM-4 antibody, Lsm4 Homolog U6 Small Nuclear Rna Associated antibody, LSM 4, LSM-4
Cross Reactivity Human
Applications WB
Immunogen LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK
Assay Information LSM4 Blocking Peptide, catalog no. 33R-3529, is also available for use as a blocking control in assays to test for specificity of this LSM4 antibody

Images

Western Blot analysis using LSM4 antibody (70R-4945)

LSM4 antibody (70R-4945) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LSM4 antibody (70R-4945) | LSM4 antibody (70R-4945) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors