LST-3TM12 antibody (70R-6339)

Rabbit polyclonal LST-3TM12 antibody raised against the middle region of LST-3TM12

Synonyms Polyclonal LST-3TM12 antibody, Anti-LST-3TM12 antibody, Organic Anion Transporter Lst-3B antibody, LST-TM12-3 antibody, LST-TM12-3, LST-3TM12, LST3 antibody, LST-TM12 3, LST-TM12 3 antibody
Specificity LST-3TM12 antibody was raised against the middle region of LST-3TM12
Cross Reactivity Human
Applications WB
Immunogen LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
Assay Information LST-3TM12 Blocking Peptide, catalog no. 33R-5109, is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody

Images

Western Blot analysis using LST-3TM12 antibody (70R-6339)

LST-3TM12 antibody (70R-6339) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LST-3TM12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LST-3TM12 antibody (70R-6339) | LST-3TM12 antibody (70R-6339) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors