LTB4DH antibody (70R-4227)

Rabbit polyclonal LTB4DH antibody raised against the N terminal Of Ltb4Dh

Synonyms Polyclonal LTB4DH antibody, Anti-LTB4DH antibody, MGC34943 antibody, LTBDH 4 antibody, LTB4DH, LTBDH 4, LTBDH-4, LTBDH-4 antibody
Specificity LTB4DH antibody was raised against the N terminal Of Ltb4Dh
Cross Reactivity Human
Applications WB
Immunogen LTB4DH antibody was raised using the N terminal Of Ltb4Dh corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR
Assay Information LTB4DH Blocking Peptide, catalog no. 33R-9791, is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody

Images

Western Blot analysis using LTB4DH antibody (70R-4227)

LTB4DH antibody (70R-4227) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LTB4DH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LTB4DH antibody (70R-4227) | LTB4DH antibody (70R-4227) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors