LTC4S antibody (70R-1852)

Affinity purified rabbit polyclonal LTC4S antibody raised against the N terminal of LTC4S

Synonyms Polyclonal LTC4S antibody, Anti-LTC4S antibody, LTCS-4, Leukotriene C4 Synthase antibody, MGC33147 antibody, LTCS 4, LTCS 4 antibody, LTC4S, LTCS-4 antibody
Specificity LTC4S antibody was raised against the N terminal of LTC4S
Cross Reactivity Human
Applications WB
Immunogen LTC4S antibody was raised using the N terminal of LTC4S corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY


Western Blot analysis using LTC4S antibody (70R-1852)

LTC4S antibody (70R-1852) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50 ul distilled water for a 1mg/ml concentration of LTC4S antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1-2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LTC4S antibody (70R-1852) | LTC4S antibody (70R-1852) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors