LYPD5 antibody (70R-4270)

Rabbit polyclonal LYPD5 antibody raised against the N terminal of LYPD5

Synonyms Polyclonal LYPD5 antibody, Anti-LYPD5 antibody, LYPD 5 antibody, Ly6/Plaur Domain Containing 5 antibody, FLJ30469 antibody, PRO4356 antibody, LYPD-5, LYPD5, LYPD-5 antibody, LYPD 5
Specificity LYPD5 antibody was raised against the N terminal of LYPD5
Cross Reactivity Human
Applications WB
Immunogen LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP
Assay Information LYPD5 Blocking Peptide, catalog no. 33R-10024, is also available for use as a blocking control in assays to test for specificity of this LYPD5 antibody


Western Blot analysis using LYPD5 antibody (70R-4270)

LYPD5 antibody (70R-4270) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LYPD5 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYPD5 antibody (70R-4270) | LYPD5 antibody (70R-4270) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors