LYPLA1 antibody (70R-2373)

Rabbit polyclonal LYPLA1 antibody raised against the middle region of LYPLA1

Synonyms Polyclonal LYPLA1 antibody, Anti-LYPLA1 antibody, LYPLA 1 antibody, LYPLA-1, LPL1 antibody, APT-1 antibody, LYSOPLA antibody, LYPLA 1, LYPLA-1 antibody, Lysophospholipase I antibody, LYPLA1
Specificity LYPLA1 antibody was raised against the middle region of LYPLA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
Assay Information LYPLA1 Blocking Peptide, catalog no. 33R-8940, is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody

Images

Western Blot analysis using LYPLA1 antibody (70R-2373)

LYPLA1 antibody (70R-2373) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPLA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LYPLA1 antibody (70R-2373) | LYPLA1 antibody (70R-2373) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors