LYPLA2 antibody (70R-3616)

Rabbit polyclonal LYPLA2 antibody raised against the N terminal of LYPLA2

Synonyms Polyclonal LYPLA2 antibody, Anti-LYPLA2 antibody, LYPLA-2, DJ886K2.4 antibody, LYPLA2, Lysophospholipase Ii antibody, LYPLA 2, APT-2 antibody, LYPLA-2 antibody, LYPLA 2 antibody
Specificity LYPLA2 antibody was raised against the N terminal of LYPLA2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Assay Information LYPLA2 Blocking Peptide, catalog no. 33R-5812, is also available for use as a blocking control in assays to test for specificity of this LYPLA2 antibody

Images

Western Blot analysis using LYPLA2 antibody (70R-3616)

LYPLA2 antibody (70R-3616) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPLA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LYPLA2 antibody (70R-3616) | LYPLA2 antibody (70R-3616) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors