LYSMD2 antibody (70R-4425)

Rabbit polyclonal LYSMD2 antibody raised against the middle region of LYSMD2

Synonyms Polyclonal LYSMD2 antibody, Anti-LYSMD2 antibody, Lysm Putative Peptidoglycan-Binding Domain Containing 2 antibody, DKFZp686I2243 antibody, LYSMD-2 antibody, LYSMD 2, LYSMD2, LYSMD-2, LYSMD 2 antibody, MGC35274 antibody
Specificity LYSMD2 antibody was raised against the middle region of LYSMD2
Cross Reactivity Human,Mouse
Applications WB
Immunogen LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
Assay Information LYSMD2 Blocking Peptide, catalog no. 33R-9496, is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody


Western Blot analysis using LYSMD2 antibody (70R-4425)

LYSMD2 antibody (70R-4425) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYSMD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYSMD2 antibody (70R-4425) | LYSMD2 antibody (70R-4425) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors