LZTS2 antibody (70R-5687)

Rabbit polyclonal LZTS2 antibody raised against the N terminal of LZTS2

Synonyms Polyclonal LZTS2 antibody, Anti-LZTS2 antibody, LZTS 2, LAPSER1 antibody, LZTS-2, LZTS2, LZTS 2 antibody, KIAA1813 antibody, Leucine Zipper Putative Tumor Suppressor 2 antibody, LZTS-2 antibody
Specificity LZTS2 antibody was raised against the N terminal of LZTS2
Cross Reactivity Human,Mouse
Applications WB
Immunogen LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
Assay Information LZTS2 Blocking Peptide, catalog no. 33R-2636, is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody

Images

Western Blot analysis using LZTS2 antibody (70R-5687)

LZTS2 antibody (70R-5687) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LZTS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LZTS2 antibody (70R-5687) | LZTS2 antibody (70R-5687) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors