MAGEA10 antibody (70R-3921)

Rabbit polyclonal MAGEA10 antibody raised against the middle region of MAGEA10

Synonyms Polyclonal MAGEA10 antibody, Anti-MAGEA10 antibody, MAGEA10, MAGEA 10 antibody, MAGE10 antibody, Melanoma Antigen Family A 10 antibody, MAGEA-10 antibody, MAGEA 10, MAGEA-10, MGC10599 antibody
Specificity MAGEA10 antibody was raised against the middle region of MAGEA10
Cross Reactivity Human
Applications WB
Immunogen MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
Assay Information MAGEA10 Blocking Peptide, catalog no. 33R-6797, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Images

Western Blot analysis using MAGEA10 antibody (70R-3921)

MAGEA10 antibody (70R-3921) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAGEA10 antibody (70R-3921) | MAGEA10 antibody (70R-3921) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors