MAGEA3 antibody (70R-3334)

Rabbit polyclonal MAGEA3 antibody raised against the middle region of MAGEA3

Synonyms Polyclonal MAGEA3 antibody, Anti-MAGEA3 antibody, MAGEA6 antibody, MAGE3 antibody, MAGEA 3, MAGEA 3 antibody, HIP8 antibody, Melanoma Antigen Family A 3 antibody, MAGEA3, MGC14613 antibody, MAGEA-3 antibody, HYPD antibody, MAGEA-3
Specificity MAGEA3 antibody was raised against the middle region of MAGEA3
Cross Reactivity Human
Applications WB
Immunogen MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
Assay Information MAGEA3 Blocking Peptide, catalog no. 33R-1420, is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody

Images

Immunohistochemical staining using MAGEA3 antibody (70R-3334)

MAGEA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MAGEA3 antibody (70R-3334) | MAGEA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MAGEA3 antibody (70R-3334) | MAGEA3 antibody (70R-3334) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors