MAGEA5 antibody (70R-4559)

Rabbit polyclonal MAGEA5 antibody raised against the N terminal of MAGEA5

Synonyms Polyclonal MAGEA5 antibody, Anti-MAGEA5 antibody, MAGEA-5 antibody, MGC129526 antibody, MAGEA5, MAGEA-5, Melanoma Antigen Family A 5 antibody, MAGEA 5 antibody, MAGE5 antibody, MAGEA 5, MAGEA4 antibody
Specificity MAGEA5 antibody was raised against the N terminal of MAGEA5
Cross Reactivity Human
Applications WB
Immunogen MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL
Assay Information MAGEA5 Blocking Peptide, catalog no. 33R-6458, is also available for use as a blocking control in assays to test for specificity of this MAGEA5 antibody


Western Blot analysis using MAGEA5 antibody (70R-4559)

MAGEA5 antibody (70R-4559) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEA5 antibody (70R-4559) | MAGEA5 antibody (70R-4559) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors