MAGEB1 antibody (70R-4381)

Rabbit polyclonal MAGEB1 antibody raised against the middle region of MAGEB1

Synonyms Polyclonal MAGEB1 antibody, Anti-MAGEB1 antibody, MAGEB 1, MAGEL1 antibody, MAGEB-1 antibody, MAGEB 1 antibody, Melanoma Antigen Family B 1 antibody, DAM10 antibody, MAGE-Xp antibody, MAGEB1, MAGEB-1, MGC9322 antibody
Specificity MAGEB1 antibody was raised against the middle region of MAGEB1
Cross Reactivity Human
Applications WB
Immunogen MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF
Assay Information MAGEB1 Blocking Peptide, catalog no. 33R-7528, is also available for use as a blocking control in assays to test for specificity of this MAGEB1 antibody

Images

Western Blot analysis using MAGEB1 antibody (70R-4381)

MAGEB1 antibody (70R-4381) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAGEB1 antibody (70R-4381) | MAGEB1 antibody (70R-4381) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors