MAGEB4 antibody (70R-4031)

Rabbit polyclonal MAGEB4 antibody raised against the N terminal of MAGEB4

Synonyms Polyclonal MAGEB4 antibody, Anti-MAGEB4 antibody, MAGEB-4 antibody, MGC33144 antibody, MAGEB 4 antibody, MAGEB 4, Melanoma Antigen Family B 4 antibody, MAGEB4, MAGEB-4
Specificity MAGEB4 antibody was raised against the N terminal of MAGEB4
Cross Reactivity Human
Applications WB
Immunogen MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD
Assay Information MAGEB4 Blocking Peptide, catalog no. 33R-4329, is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody

Western blot analysis using MAGEB4 antibody (70R-4031)

Recommended MAGEB4 Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using MAGEB4 antibody (70R-4031) | Recommended MAGEB4 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors