MAN1A2 antibody (70R-6984)

Rabbit polyclonal MAN1A2 antibody raised against the middle region of MAN1A2

Synonyms Polyclonal MAN1A2 antibody, Anti-MAN1A2 antibody, MANA2-1, MAN1A2, MANA2 1, Mannosidase Alpha Class 1A Member 2 antibody, MANA2-1 antibody, MAN1B antibody, MANA2 1 antibody
Specificity MAN1A2 antibody was raised against the middle region of MAN1A2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAN1A2 antibody was raised using the middle region of MAN1A2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
Assay Information MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody

Images

Western Blot analysis using MAN1A2 antibody (70R-6984)

MAN1A2 antibody (70R-6984) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAN1A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAN1A2 antibody (70R-6984) | MAN1A2 antibody (70R-6984) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors