MANEA antibody (70R-7439)

Rabbit polyclonal MANEA antibody raised against the middle region of MANEA

Synonyms Polyclonal MANEA antibody, Anti-MANEA antibody, DKFZp686D20120 antibody, FLJ12838 antibody, Mannosidase Endo-Alpha antibody, hEndo antibody
Specificity MANEA antibody was raised against the middle region of MANEA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV
Assay Information MANEA Blocking Peptide, catalog no. 33R-4723, is also available for use as a blocking control in assays to test for specificity of this MANEA antibody

Images

Western Blot analysis using MANEA antibody (70R-7439)

MANEA antibody (70R-7439) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MANEA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MANEA antibody (70R-7439) | MANEA antibody (70R-7439) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors